PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592164.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 346aa    MW: 39324.6 Da    PI: 8.7527
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592164.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP135.93.4e-421032442131
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt.......ssssasec.....eaesssssasn 84 
                     a kkdrhski T+ g+RdRR+Rls+++a++fF Lqd LGfdk+skt+eWLl+++k ai el+++       +ss+ sec      +es   ++ +
  XP_009592164.1 103 AYKKDRHSKINTAHGPRDRRMRLSLDVARKFFNLQDLLGFDKASKTVEWLLTKSKSAINELVQStatgaisTSSTTSECevisgIDESTTTNDIQ 197
                     679*************************************************************8887776444446776665433333333334 PP

             TCP  85 sssgkaaksaakskksqksaasalnlakesrakarararertrekmr 131
                     ++ ++++  ++k+ ++ ++ a+++ +akesr++arararert+ k++
  XP_009592164.1 198 KQPNRSEVGEKKKANKLARRAAFNPVAKESRKQARARARERTKIKKS 244
                     444477777777777777788899999***************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136935.634105163IPR017887Transcription factor TCP subgroup
PfamPF036344.4E-44105243IPR005333Transcription factor, TCP
PROSITE profilePS5137010.477225242IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MYPSSNICNY NPNISSSNNF FHIPSPNSMQ YEHELFQYFH DHHLLQPQQQ QQLLLTTPDH  60
YMAADSNKDT VIRSTINQLE GPKEVELQGS FKNKNGANKR AVAYKKDRHS KINTAHGPRD  120
RRMRLSLDVA RKFFNLQDLL GFDKASKTVE WLLTKSKSAI NELVQSTATG AISTSSTTSE  180
CEVISGIDES TTTNDIQKQP NRSEVGEKKK ANKLARRAAF NPVAKESRKQ ARARARERTK  240
IKKSLLNIGD QSMAADDLKR LGCWSPFETG EESGIQGYST NHQVEDQHTT NHEEHLLGTK  300
ENADGSNLVV TGNWNPFTVF NYHHNTEISH EHQFTNFQFS GKFWEV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1949531e-180FJ194953.1 Nicotiana tabacum TCP1 protein-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592164.10.0PREDICTED: transcription factor DICHOTOMA-like
RefseqXP_009592171.10.0PREDICTED: transcription factor DICHOTOMA-like
TrEMBLG0ZGI89e-96G0ZGI8_PETHY; Putative transcription factor (Fragment)
STRINGSolyc03g119770.2.13e-82(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24822256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.18e-27TCP domain protein 12